| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gonadotropin-releasing hormone receptor |
|---|
| Ligand | BDBM50067485 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_100010 (CHEMBL710695) |
|---|
| IC50 | 0.6±n/a nM |
|---|
| Citation |  Sasaki, S; Cho, N; Nara, Y; Harada, M; Endo, S; Suzuki, N; Furuya, S; Fujino, M Discovery of a thieno[2,3-d]pyrimidine-2,4-dione bearing a p-methoxyureidophenyl moiety at the 6-position: a highly potent and orally bioavailable non-peptide antagonist for the human luteinizing hormone-releasing hormone receptor. J Med Chem46:113-24 (2002) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gonadotropin-releasing hormone receptor |
|---|
| Name: | Gonadotropin-releasing hormone receptor |
|---|
| Synonyms: | GNRHR | GNRHR_HUMAN | GRHR | GnRH receptor | GnRH-R | Gonadotropin releasing hormone 1 (GnRHR1) | Gonadotropin-releasing hormone receptor | Gonadotropin-releasing hormone receptor (GnRH) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37749.45 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30968 |
|---|
| Residue: | 328 |
|---|
| Sequence: | MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
|
|
|
|---|
| BDBM50067485 |
|---|
| n/a |
|---|
| Name | BDBM50067485 |
|---|
| Synonyms: | 3-[(Benzyl-methyl-amino)-methyl]-7-(2,6-difluoro-benzyl)-2-(4-isobutyrylamino-phenyl)-4-oxo-4,7-dihydro-thieno[2,3-b]pyridine-5-carboxylic acid isopropyl ester; hydrochloride | CHEMBL544440 | CHEMBL71917 | T-98475 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H37F2N3O4S |
|---|
| Mol. Mass. | 657.769 |
|---|
| SMILES | CC(C)OC(=O)c1cn(Cc2c(F)cccc2F)c2sc(c(CN(C)Cc3ccccc3)c2c1=O)-c1ccc(NC(=O)C(C)C)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
