Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEDNRB
LigandBDBM50122700
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63850
Ki 1500±n/a nM
Citation Murugesan NGu ZSpergel SYoung MChen PMathur ALeith LHermsmeier MLiu ECZhang RBird EWaldron TMarino AKoplowitz BHumphreys WGChong SMorrison RAWebb MLMoreland STrippodo NBarrish JC Biphenylsulfonamide endothelin receptor antagonists. 4. Discovery of N-[[2'-[[(4,5-dimethyl-3-isoxazolyl)amino]sulfonyl]-4-(2-oxazolyl)[1,1'-biphenyl]- 2-yl]methyl]-N,3,3-trimethylbutanamide (BMS-207940), a highly potent and orally active ET(A) selective antagonist. J Med Chem 46:125-37 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
EDNRB
Name:Endothelin receptor, ET-A/ET-B
Synonyms:ENDOTHELIN B | ET-B | Endothelin receptor ET-B | Endothelin receptor non-selective type | Endothelin receptor, ET-A/ET-B
Type:Enzyme Catalytic Domain
Mol. Mass.:49664.00
Organism:Homo sapiens (Human)
Description:ENDOTHELIN B EDNRB HUMAN::P24530
Residue:442
Sequence:
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA
SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122700
n/a
NameBDBM50122700
Synonyms:4'-Oxazol-2-yl-2'-(3-trifluoromethyl-pyrazol-1-ylmethyl)-biphenyl-2-sulfonic acid (3,4-dimethyl-isoxazol-5-yl)-amide | CHEMBL285832
TypeSmall organic molecule
Emp. Form.C25H20F3N5O4S
Mol. Mass.543.518
SMILESCc1noc(NS(=O)(=O)c2ccccc2-c2ccc(cc2Cn2ccc(n2)C(F)(F)F)-c2ncco2)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: