Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2D1
LigandBDBM112777
Substrate/Competitorn/a
Meas. Tech.ChEMBL_51708
IC50 204000±n/a nM
Citation Venhorst Jter Laak AMCommandeur JNFunae YHiroi TVermeulen NP Homology modeling of rat and human cytochrome P450 2D (CYP2D) isoforms and computational rationalization of experimental ligand-binding specificities. J Med Chem 46:74-86 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2D1
Name:Cytochrome P450 2D1
Synonyms:CYPIID1 | Debrisoquine 4-hydroxylase | P450-CMF1A | P450-DB1 | P450-UT-7
Type:PROTEIN
Mol. Mass.:57179.81
Organism:Rattus norvegicus
Description:ChEMBL_51708
Residue:504
Sequence:
MELLNGTGLWSMAIFTVIFILLVDLMHRRHRWTSRYPPGPVPWPVLGNLLQVDLSNMPYS
LYKLQHRYGDVFSLQKGWKPMVIVNRLKAVQEVLVTHGEDTADRPPVPIFKCLGVKPRSQ
GVILASYGPEWREQRRFSVSTLRTFGMGKKSLEEWVTKEAGHLCDAFTAQAGQSINPKAM
LNKALCNVIASLIFARRFEYEDPYLIRMVKLVEESLTEVSGFIPEVLNTFPALLRIPGLA
DKVFQGQKTFMALLDNLLAENRTTWDPAQPPRNLTDAFLAEVEKAKGNPESSFNDENLRM
VVVDLFTAGMVTTATTLTWALLLMILYPDVQRRVQQEIDEVIGQVRCPEMTDQAHMPYTN
AVIHEVQRFGDIAPLNLPRFTSCDIEVQDFVIPKGTTLIINLSSVLKDETVWEKPHRFHP
EHFLDAQGNFVKHEAFMPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSVPVGQPRPST
HGFFAFPVAPLPYQLCAVVREQGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM112777
n/a
NameBDBM112777
Synonyms:NORTRIPTYLINE | US8629135, SW-02
TypeSmall organic molecule
Emp. Form.C19H21N
Mol. Mass.263.3767
SMILES[#6]-[#7]-[#6]-[#6]\[#6]=[#6]-1/c2ccccc2-[#6]-[#6]-c2ccccc-12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: