Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50128098
Substrate/Competitorn/a
Meas. Tech.ChEMBL_46981
Ki 110±n/a nM
Citation Wrobleski STChen PHynes JLin SNorris DJPandit CRSpergel SWu HTokarski JSChen XGillooly KMKiener PAMcIntyre KWPatil-Koota VShuster DJTurk LAYang GLeftheris K Rational design and synthesis of an orally active indolopyridone as a novel conformationally constrained cannabinoid ligand possessing antiinflammatory properties. J Med Chem 46:2110-6 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50128098
n/a
NameBDBM50128098
Synonyms:2-Ethyl-7-methoxy-1-(2-morpholin-4-yl-ethyl)-1H-indole-3-carboxylic acid (1,3,3-trimethyl-bicyclo[2.2.1]hept-2-yl)-amide | CHEMBL304043
TypeSmall organic molecule
Emp. Form.C28H41N3O3
Mol. Mass.467.6434
SMILESCCc1c(C(=O)NC2[C@@]3(C)CC[C@H](C3)C2(C)C)c2cccc(OC)c2n1CCN1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: