Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeucine aminopeptidase
LigandBDBM50129683
Substrate/Competitorn/a
Meas. Tech.ChEMBL_98401
Ki 65±n/a nM
Citation Grembecka JMucha ACierpicki TKafarski P The most potent organophosphorus inhibitors of leucine aminopeptidase. Structure-based design, chemistry, and activity. J Med Chem 46:2641-55 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leucine aminopeptidase
Name:Aminopeptidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:56171.75
Organism:Homo sapiens (Human)
Description:ChEMBL_1507539
Residue:519
Sequence:
MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFD
KLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN
IRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGS
GDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWI
EEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMD
LMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL
DIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50129683
n/a
NameBDBM50129683
Synonyms:2-[(1-Amino-3-methyl-butyl)-hydroxy-phosphinoylmethyl]-4-methyl-pentanoic acid | CHEMBL2153736 | CHEMBL328319 | Diastereomer-2-[(1-Amino-3-methyl-butyl)-hydroxy-phosphinoylmethyl]-4-methyl-pentanoic acid
TypeSmall organic molecule
Emp. Form.C12H26NO4P
Mol. Mass.279.3129
SMILESCC(C)CC(CP(O)(O)C(=N)CC(C)C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: