Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeucine aminopeptidase
LigandBDBM23971
Substrate/Competitorn/a
Meas. Tech.ChEMBL_98401
Ki 0.6±n/a nM
Citation Grembecka JMucha ACierpicki TKafarski P The most potent organophosphorus inhibitors of leucine aminopeptidase. Structure-based design, chemistry, and activity. J Med Chem 46:2641-55 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leucine aminopeptidase
Name:Aminopeptidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:56171.75
Organism:Homo sapiens (Human)
Description:ChEMBL_1507539
Residue:519
Sequence:
MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFD
KLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN
IRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGS
GDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWI
EEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMD
LMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL
DIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23971
n/a
NameBDBM23971
Synonyms:(2S)-2-[(2S,3R)-3-amino-2-hydroxy-4-phenylbutanamido]-4-methylpentanoic acid | Bestatin | CHEMBL29292 | Ubenimex
TypeSmall organic molecule
Emp. Form.C16H24N2O4
Mol. Mass.308.3728
SMILESCC(C)C[C@H](NC(=O)[C@@H](O)[C@H](N)Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: