Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT5
LigandBDBM50007407
Substrate/Competitorn/a
Meas. Tech.ChEMBL_3592
Ki 40±n/a nM
Citation Glennon RA Higher-end serotonin receptors: 5-HT(5), 5-HT(6), and 5-HT(7). J Med Chem 46:2795-812 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-HT5
Name:5-HT5
Synonyms:5-HT-5 | 5-HT-5A | 5-HT5a | 5-hydroxytryptamine receptor 5A | Serotonin 5a (5-HT5a) receptor | Serotonin receptor 5A
Type:Enzyme Catalytic Domain
Mol. Mass.:40749.33
Organism:MOUSE
Description:5-HT5 0 MOUSE::P30966
Residue:357
Sequence:
MDLPVNLTSFSLSTPSSLEPNRSLDTEVLRPSRPFLSAFRVLVLTLLGFLAAATFTWNLL
VLATILKVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRKRVSNVMILLTWALSTVISLAPLLFG
WGETYSEPSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYRAAKFRMGSRKTNSVS
PVPEAVEVKNATQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP
FFVTELISPLCSWDVPAIWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007407
n/a
NameBDBM50007407
Synonyms:1-NP | 1-Naphthalen-1-yl-piperazine | 4-Naphthalen-1-yl-piperazin-1-ium | CHEMBL277120
TypeSmall organic molecule
Emp. Form.C14H16N2
Mol. Mass.212.2902
SMILESC1CN(CCN1)c1cccc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: