| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM82551 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_148867 (CHEMBL753745) |
|---|
| Ki | 65±n/a nM |
|---|
| Citation |  Thomas, JB; Atkinson, RN; Vinson, NA; Catanzaro, JL; Perretta, CL; Fix, SE; Mascarella, SW; Rothman, RB; Xu, H; Dersch, CM; Cantrell, BE; Zimmerman, DM; Carroll, FI Identification of (3R)-7-hydroxy-N-((1S)-1-[[(3R,4R)-4-(3-hydroxyphenyl)- 3,4-dimethyl-1-piperidinyl]methyl]-2-methylpropyl)-1,2,3,4-tetrahydro- 3-isoquinolinecarboxamide as a novel potent and selective opioid kappa receptor antagonist. J Med Chem46:3127-37 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM82551 |
|---|
| n/a |
|---|
| Name | BDBM82551 |
|---|
| Synonyms: | C18130 | CAS_105618-26-6 | NOR-BNI (HCI)2 | NORBNI |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H43N3O6 |
|---|
| Mol. Mass. | 661.7859 |
|---|
| SMILES | Oc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)c1[nH]c2[C@@H]4Oc6c7c(C[C@H]8N(CC9CC9)CC[C@@]47[C@@]8(O)Cc2c1C[C@@]35O)ccc6O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
