| Reaction Details |
|---|
 | Report a problem with these data |
| Target | NH(3)-dependent NAD(+) synthetase |
|---|
| Ligand | BDBM92600 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_141613 (CHEMBL747929) |
|---|
| IC50 | 10000±n/a nM |
|---|
| Citation |  Velu, SE; Cristofoli, WA; Garcia, GJ; Brouillette, CG; Pierson, MC; Luan, CH; DeLucas, LJ; Brouillette, WJ Tethered dimers as NAD synthetase inhibitors with antibacterial activity. J Med Chem46:3371-81 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| NH(3)-dependent NAD(+) synthetase |
|---|
| Name: | NH(3)-dependent NAD(+) synthetase |
|---|
| Synonyms: | GSP38 | General stress protein 38 | NADE_BACSU | Spore outgrowth factor B | Sporulation protein outB | nadE | outB |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30386.77 |
|---|
| Organism: | Bacillus subtilis |
|---|
| Description: | ChEMBL_141613 |
|---|
| Residue: | 272 |
|---|
| Sequence: | MSMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQ
LAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQ
QETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLL
PLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKE
VSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
|
|
|
|---|
| BDBM92600 |
|---|
| n/a |
|---|
| Name | BDBM92600 |
|---|
| Synonyms: | CHEMBL419944 | NAD Synthetase Inhibitor, 5 |
|---|
| Type | Organic molecule |
|---|
| Emp. Form. | C30H41N2O4 |
|---|
| Mol. Mass. | 493.657 |
|---|
| SMILES | COC(=O)c1cc2ccccc2n1CCCCCCCCCOC(=O)Cc1ccc(cc1)[N+](C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
