Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidylate kinase
LigandBDBM50118628
Substrate/Competitorn/a
Meas. Tech.ChEMBL_208211
Ki 10000±n/a nM
Citation Vanheusden VMunier-Lehmann HFroeyen MDugué LHeyerick ADe Keukeleire DPochet SBusson RHerdewijn PVan Calenbergh S 3'-C-branched-chain-substituted nucleosides and nucleotides as potent inhibitors of Mycobacterium tuberculosis thymidine monophosphate kinase. J Med Chem 46:3811-21 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thymidylate kinase
Name:Thymidylate kinase
Synonyms:TMPK | Thymidine monophosphate kinase | dTMP kinase
Type:PROTEIN
Mol. Mass.:22636.29
Organism:Mycobacterium tuberculosis
Description:ChEMBL_208218
Residue:214
Sequence:
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV
QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA
ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118628
n/a
NameBDBM50118628
Synonyms:(R)-1-((R)-4-Azido-5-methylphosphate-tetrahydro-furan-2-yl)-5-methyl-1H-pyrimidine-2,4-dione | Phosphoric acid mono-[3-azido-5-(5-methyl-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl)-tetrahydro-furan-2-ylmethyl] ester
TypeSmall organic molecule
Emp. Form.C10H12N5O7P
Mol. Mass.345.2064
SMILESCc1cn([C@H]2C[C@H](N=[N+]=[N-])[C@@H](COP([O-])([O-])=O)O2)c(=O)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: