Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCollagenase
LigandBDBM30344
Substrate/Competitorn/a
Meas. Tech.ChEMBL_105365
IC50 58±n/a nM
Citation Le Diguarher TChollet AMBertrand MHennig PRaimbaud ESabatini MGuilbaud NPierré ATucker GCCasara P Stereospecific synthesis of 5-substituted 2-bisarylthiocyclopentane carboxylic acids as specific matrix metalloproteinase inhibitors. J Med Chem 46:3840-52 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Collagenase
Name:Matrix metalloproteinase 2/9
Synonyms:67 kDa matrix metalloproteinase-9 | 82 kDa matrix metalloproteinase-9 | 92 kDa gelatinase | 92 kDa type IV collagenase | GELB | Gelatinase B | MMP-9 | Matrix metalloproteinase 9 (MMP-9) | Matrix metalloproteinase-9 | Matrix metalloproteinase-9 (MMP-9) | Matrix metalloproteinase-9 (MMP9)
Type:Enzyme
Mol. Mass.:78452.28
Organism:Homo sapiens (Human)
Description:P14780
Residue:707
Sequence:
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM30344
n/a
NameBDBM30344
Synonyms:Cipemastat | Trocade
TypeSmall organic molecule
Emp. Form.C22H36N4O5
Mol. Mass.436.545
SMILESCN1C(=O)N(C[C@@H]([C@@H](CC2CCCC2)C(=O)N2CCCCC2)C(=O)NO)C(=O)C1(C)C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: