Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHydroxycarboxylic acid receptor 2
LigandBDBM23515
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144336
Ki 33±n/a nM
Citation van Herk TBrussee Jvan den Nieuwendijk AMvan der Klein PAIJzerman APStannek CBurmeister ALorenzen A Pyrazole derivatives as partial agonists for the nicotinic acid receptor. J Med Chem 46:3945-51 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hydroxycarboxylic acid receptor 2
Name:Hydroxycarboxylic acid receptor 2
Synonyms:HM74 nicotinic acid GPCR
Type:PROTEIN
Mol. Mass.:41476.06
Organism:Rattus norvegicus
Description:ChEMBL_820675
Residue:360
Sequence:
MSKQNHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSR
IFLFNLAVADFLLIICLPFLTDNYVQNWDWRFGSIPCRVMLFMLAMNRQGSIIFLTVVAV
DRYFRVVHPHHFLNKISNRTAAIISCFLWGITIGLTVHLLYTDMMTRNGDANLCSSFSIC
YTFRWHDAMFLLEFFLPLGIILFCSGRIIWSLRQRQMDRHVKIKRAINFIMVVAIVFVIC
FLPSVAVRIRIFWLLYKHNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPN
FFSTCINRCLRRKTLGEPDNNRSTSVELTGDPSTIRSIPGALMTDPSEPGSPPYLASTSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23515
n/a
NameBDBM23515
Synonyms:CHEMBL573 | Niacin | Nicotinic Acid | [5, 6-3H]-niacin | pyridine-3-carboxylic acid | wampocap
TypeSmall organic molecule
Emp. Form.C6H5NO2
Mol. Mass.123.1094
SMILESOC(=O)c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: