Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPKC alpha and beta-2
LigandBDBM50133059
Substrate/Competitorn/a
Meas. Tech.ChEMBL_160613
IC50 46±n/a nM
Citation Kuo GHProuty CDeAngelis AShen LO'Neill DJShah CConnolly PJMurray WVConway BRCheung PWestover LXu JZLook RADemarest KTEmanuel SMiddleton SAJolliffe LBeavers MPChen X Synthesis and discovery of macrocyclic polyoxygenated bis-7-azaindolylmaleimides as a novel series of potent and highly selective glycogen synthase kinase-3beta inhibitors. J Med Chem 46:4021-31 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
PKC alpha and beta-2
Name:PKC alpha and beta-2
Synonyms:PKC beta | PKC beta isoform 2 | Protein Kinase C, beta II | Protein kinase C beta type | Protein kinase C beta type II (PRKCB2)
Type:Enzyme
Mol. Mass.:76873.67
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:671
Sequence:
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133059
n/a
NameBDBM50133059
Synonyms:17,20,23-trioxa-4,12,14,26-tetraazahexacyclo[24.6.1.17,14.02,6.08,13.027,32]tetratriaconta-1(33),2(6),7(34),8,10,12,27,29,31-nonaene-3,5-dione | CHEMBL340935 | Indolylylmaleimide 1
TypeSmall organic molecule
Emp. Form.C27H26N4O5
Mol. Mass.486.5191
SMILESO=C1NC(=O)C2=C1c1cn(CCOCCOCCOCCn3cc2c2cccnc32)c2ccccc12 |c:5|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: