Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-chymotrypsin
LigandBDBM50002861
Substrate/Competitorn/a
Meas. Tech.ChEMBL_49921
IC50 200000±n/a nM
Citation Seidler JMcGovern SLDoman TNShoichet BK Identification and prediction of promiscuous aggregating inhibitors among known drugs. J Med Chem 46:4477-86 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-chymotrypsin
Name:Alpha-chymotrypsin
Synonyms:Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin)
Type:Serine protease
Mol. Mass.:25670.88
Organism:Bos taurus (bovine)
Description:n/a
Residue:245
Sequence:
CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002861
n/a
NameBDBM50002861
Synonyms:3-(4,5-Diphenyl-oxazol-2-yl)-propionic acid | CHEMBL1071 | Daypro | OXAPROZIN | WY-21743 | oxaprosin
TypeSmall organic molecule
Emp. Form.C18H15NO3
Mol. Mass.293.3166
SMILESOC(=O)CCc1nc(c(o1)-c1ccccc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: