Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMalate dehydrogenase cytoplasmic
LigandBDBM25817
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104019
IC50>400000±n/a nM
Citation Seidler JMcGovern SLDoman TNShoichet BK Identification and prediction of promiscuous aggregating inhibitors among known drugs. J Med Chem 46:4477-86 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Malate dehydrogenase cytoplasmic
Name:Malate dehydrogenase cytoplasmic
Synonyms:Cytosolic malate dehydrogenase | Malate dehydrogenase, cytoplasmic
Type:PROTEIN
Mol. Mass.:36427.72
Organism:Homo sapiens (Human)
Description:ChEMBL_1456624
Residue:334
Sequence:
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDC
ALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYA
KKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKN
VIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKL
SSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFV
EGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25817
n/a
NameBDBM25817
Synonyms:2-(2,4-difluorophenyl)-1,3-bis(1H-1,2,4-triazol-1-yl)propan-2-ol | CHEMBL106 | Diflucan | Fluconazole | Fluconazole (f) | Fungata | Triflucan | US9138393, Fluconazole | US9144538, Fluconazole | US9221791, Fluconazole | US9556143, Fluconazole | cid_3365
TypeSmall organic molecule
Emp. Form.C13H12F2N6O
Mol. Mass.306.2708
SMILESOC(Cn1cncn1)(Cn1cncn1)c1ccc(F)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: