Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase AmpC
LigandBDBM31768
Substrate/Competitorn/a
Meas. Tech.ChEMBL_40567
IC50>150000±n/a nM
Citation Seidler JMcGovern SLDoman TNShoichet BK Identification and prediction of promiscuous aggregating inhibitors among known drugs. J Med Chem 46:4477-86 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase AmpC
Name:Beta-lactamase AmpC
Synonyms:Beta-lactamase | Beta-lactamase (AmpC) | Cephalosporinase | Escherichia coli K-12
Type:Protien
Mol. Mass.:41561.62
Organism:Escherichia coli
Description:P00811
Residue:377
Sequence:
MFKTTLCALLITASCSTFAAPQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWG
YADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGI
TLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVK
PSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVK
STIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSII
NGSDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNY
PNPARVDAAWQILNALQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31768
n/a
NameBDBM31768
Synonyms:CHEMBL295698 | Ketoconazole | Nizoral | Panfungol
TypeSmall organic molecule
Emp. Form.C26H28Cl2N4O4
Mol. Mass.531.431
SMILESCC(=O)N1CCN(CC1)c1ccc(OC[C@@H]2CO[C@](Cn3ccnc3)(O2)c2ccc(Cl)cc2Cl)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: