| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nuclear receptor subfamily 1 group I member 3 |
|---|
| Ligand | BDBM50134722 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_48049 (CHEMBL666774) |
|---|
| IC50 | 250±n/a nM |
|---|
| Citation |  Jyrkkärinne, J; Mäkinen, J; Gynther, J; Savolainen, H; Poso, A; Honkakoski, P Molecular determinants of steroid inhibition for the mouse constitutive androstane receptor. J Med Chem46:4687-95 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nuclear receptor subfamily 1 group I member 3 |
|---|
| Name: | Nuclear receptor subfamily 1 group I member 3 |
|---|
| Synonyms: | Car | Constitutive androstane receptor | NR1I3_MOUSE | Nr1i3 | Nuclear receptor subfamily 1 group I member 3 | Orphan nuclear receptor MB67 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 40922.30 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_48051 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MTAMLTLETMASEEEYGPRNCVVCGDRATGYHFHALTCEGCKGFFRRTVSKTIGPICPFA
GRCEVSKAQRRHCPACRLQKCLNVGMRKDMILSAEALALRRARQAQRRAEKASLQLNQQQ
KELVQILLGAHTRHVGPMFDQFVQFKPPAYLFMHHRPFQPRGPVLPLLTHFADINTFMVQ
QIIKFTKDLPLFRSLTMEDQISLLKGAAVEILHISLNTTFCLQTENFFCGPLCYKMEDAV
HAGFQYEFLESILHFHKNLKGLHLQEPEYVLMAATALFSPDRPGVTQREEIDQLQEEMAL
ILNNHIMEQQSRLQSRFLYAKLMGLLADLRSINNAYSYELQRLEELSAMTPLLGEICS
|
|
|
|---|
| BDBM50134722 |
|---|
| n/a |
|---|
| Name | BDBM50134722 |
|---|
| Synonyms: | 5alpha-androst-16-en-3alpha-ol | CHEMBL142348 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H30O |
|---|
| Mol. Mass. | 274.4409 |
|---|
| SMILES | C[C@]12CC[C@H]3[C@@H](CC[C@H]4C[C@H](O)CC[C@]34C)[C@@H]1CC=C2 |r,c:21| |
|---|
| Structure | 
|
|---|
Search and Browse
