Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50123656 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_146914 (CHEMBL757502) |
---|
Ki | 2.01±n/a nM |
---|
Citation | Bishop, MJ; Garrido, DM; Boswell, GE; Collins, MA; Harris, PA; McNutt, RW; O'Neill, SJ; Wei, K; Chang, KJ 3-(alphaR)-alpha-((2S,5R)-4-allyl-2,5-dimethyl-1-piperazinyl)-3-hydroxybenzyl)-N-alkyl-N-arylbenzamides: potent, non-peptidic agonists of both the micro and delta opioid receptors. J Med Chem46:623-33 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50123656 |
---|
n/a |
---|
Name | BDBM50123656 |
Synonyms: | 3-[(R)-((2S,5R)-4-Allyl-2,5-dimethyl-piperazin-1-yl)-(3-hydroxy-phenyl)-methyl]-N-(4-methoxy-phenyl)-N-methyl-benzamide | CHEMBL346514 |
Type | Small organic molecule |
Emp. Form. | C31H37N3O3 |
Mol. Mass. | 499.6438 |
SMILES | COc1ccc(cc1)N(C)C(=O)c1cccc(c1)[C@@H](N1C[C@@H](C)N(CC=C)C[C@@H]1C)c1cccc(O)c1 |
Structure |
|