Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 receptor
LigandBDBM50126899
Substrate/Competitorn/a
Meas. Tech.ChEMBL_85342
Kd 3981.07±n/a nM
Citation Mikó TLigneau XPertz HHGanellin CRArrang JMSchwartz JCSchunack WStark H Novel nonimidazole histamine H3 receptor antagonists: 1-(4-(phenoxymethyl)benzyl)piperidines and related compounds. J Med Chem 46:1523-30 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40567.22
Organism:Cavia porcellus (domestic guinea pig)
Description:For the H2 receptor-binding assays, guinea pig striatum was used.
Residue:359
Sequence:
MAFNGTVPSFCMDFTVYKVTISVILIILILVTVAGNVVVCLAVGLNRRLRSLTNCFIVSL
AVTDLLLGLLVLPFSAIYQLSCKWSFSKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLITPARVAISLVFIWVISITLSFLSIHLGWNSRNETSKDNDTIVKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYFRIFKIAREQARRINHIGSWKAATIREHKATVTLAAVM
GAFIICWFPYFTVFVYRGLKGDDAVNEVFEDVVLWLGYANSALNPILYAALNRDFRTAYH
QLFCCRLASHNSHETSLRLNNSQLNRSQCQEPRWQEDKPLNLQVWSGTEVTAPQGATNR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50126899
n/a
NameBDBM50126899
Synonyms:1-[4-(4-Piperidin-1-ylmethyl-benzyloxy)-phenyl]-ethanone O-methyl-oxime; compound with oxalic acid | CHEMBL35869
TypeSmall organic molecule
Emp. Form.C22H28N2O2
Mol. Mass.352.4699
SMILESCO\N=C(/C)c1ccc(OCc2ccc(CN3CCCCC3)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: