Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHRH3
LigandBDBM50126878
Substrate/Competitorn/a
Meas. Tech.ChEMBL_83477
Kd 15.85±n/a nM
Citation Mikó TLigneau XPertz HHGanellin CRArrang JMSchwartz JCSchunack WStark H Novel nonimidazole histamine H3 receptor antagonists: 1-(4-(phenoxymethyl)benzyl)piperidines and related compounds. J Med Chem 46:1523-30 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HRH3
Name:Histamine H3 receptor
Synonyms:HISTAMINE H3 | Histamine H3 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48753.61
Organism:GUINEA PIG
Description:HISTAMINE H3 HRH3 GUINEA PIG::Q9JI35
Residue:445
Sequence:
MERAPPDGLMNASGALAGEAAAAAGGARTFSAAWTAVLAALMALLIVATVLGNALVMLAF
VADSSLRTQNNFFLLNLAISDFLVGVFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCT
SSVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMVLVWVLAFLLYGPAILSWEYLSG
GSSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGARE
AGPDPLPEAQSSPPQPPPGCWGCWPKGQGESMPLHRYGVGEAGPGAEAGEAALGGGSGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50126878
n/a
NameBDBM50126878
Synonyms:1-[4-(4-Imidazol-1-yl-phenoxymethyl)-benzyl]-piperidine; compound with oxalic acid | CHEMBL38123
TypeSmall organic molecule
Emp. Form.C22H25N3O
Mol. Mass.347.4534
SMILESC(Oc1ccc(cc1)-n1ccnc1)c1ccc(CN2CCCCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: