Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP-glycoprotein 1 and 3 (MDR1a/MDR1b)
LigandBDBM22893
Substrate/Competitorn/a
Meas. Tech.ChEMBL_148001
IC50>50000±n/a nM
Citation Schwab DFischer HTabatabaei APoli SHuwyler J Comparison of in vitro P-glycoprotein screening assays: recommendations for their use in drug discovery. J Med Chem 46:1716-25 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
P-glycoprotein 1 and 3 (MDR1a/MDR1b)
Name:P-glycoprotein 1 and 3 (MDR1a/MDR1b)
Synonyms:ATP-binding cassette sub-family B member 1 | CD_antigen=CD243 | Multidrug resistance protein 1 | P-glycoprotein 1
Type:PROTEIN
Mol. Mass.:141009.67
Organism:Mus musculus
Description:ChEMBL_474396
Residue:1276
Sequence:
MEFEENLKGRADKNFSKMGKKSKKEKKEKKPAVGVFGMFRYADWLDKLCMILGTLAAIIH
GTLLPLLMLVFGNMTDSFTKAEASILPSITNQSGPNSTLIISNSSLEEEMAIYAYYYTGI
GAGVLIVAYIQVSLWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSK
INDGIGDKIGMFFQSITTFLAGFIIGFISGWKLTLVILAVSPLIGLSSALWAKVLTSFTN
KELQAYAKAGAVAEEVLAAIRTVIAFGGQQKELERYNKNLEEAKNVGIKKAITASISIGI
AYLLVYASYALAFWYGTSLVLSNEYSIGEVLTVFFSILLGTFSIGHLAPNIEAFANARGA
AFEIFKIIDNEPSIDSFSTKGYKPDSIMGNLEFKNVHFNYPSRSEVQILKGLNLKVKSGQ
TVALVGNSGCGKSTTVQLMQRLYDPLEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFA
TTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAI
ARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGF
DGGVIVEQGNHDELMREKGIYFKLVMTQTRGNEIEPGNNAYGSQSDTDASELTSEESKSP
LIRRSIYRSVHRKQDQERRLSMKEAVDEDVPLVSFWRILNLNLSEWPYLLVGVLCAVING
CIQPVFAIVFSRIVGVFSRDDDHETKRQNCNLFSLFFLVMGLISFVTYFFQGFTFGKAGE
ILTKRVRYMVFKSMLRQDISWFDDHKNSTGSLTTRLASDASSVKGAMGARLAVVTQNVAN
LGTGVILSLVYGWQLTLLLVVIIPLIVLGGIIEMKLLSGQALKDKKQLEISGKIATEAIE
NFRTIVSLTREQKFETMYAQSLQVPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAY
LVAQQLMTFENVMLVFSAVVFGAMAAGNTSSFAPDYAKAKVSASHIIRIIEKTPEIDSYS
TEGLKPTLLEGNVKFNGVQFNYPTRPNIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQL
LERFYDPMAGSVFLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRAVSH
EEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEA
TSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIENGKVKEHGTHQQLLA
QKGIYFSMVQAGAKRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22893
n/a
NameBDBM22893
Synonyms:CHEMBL512 | Ranitidine | ZANTAC | dimethyl[(5-{[(2-{[(E)-1-(methylamino)-2-nitroethenyl]amino}ethyl)sulfanyl]methyl}furan-2-yl)methyl]amine
TypeSmall organic molecule
Emp. Form.C13H22N4O3S
Mol. Mass.314.404
SMILESCN\C([CH-][N+]([O-])=O)=[NH+]/CCSCc1ccc(CN(C)C)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: