Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDipeptidyl peptidase IV
LigandBDBM50287059
Substrate/Competitorn/a
Meas. Tech.ChEMBL_53378
Ki 2±n/a nM
Citation Magnin DRRobl JASulsky RBAugeri DJHuang YSimpkins LMTaunk PCBetebenner DARobertson JGAbboa-Offei BEWang ACap MXin LTao LSitkoff DFMalley MFGougoutas JZKhanna AHuang QHan SPParker RAHamann LG Synthesis of novel potent dipeptidyl peptidase IV inhibitors with enhanced chemical stability: interplay between the N-terminal amino acid alkyl side chain and the cyclopropyl group of alpha-aminoacyl-l-cis-4,5-methanoprolinenitrile-based inhibitors. J Med Chem 47:2587-98 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dipeptidyl peptidase IV
Name:Dipeptidyl peptidase IV
Synonyms:CD26 | CD_antigen=CD26 | DPP IV | Dipeptidyl peptidase 4 | Dipeptidyl peptidase 4 membrane form | Dipeptidyl peptidase 4 soluble form | Dipeptidyl peptidase IV membrane form | Dipeptidyl peptidase IV soluble form | T-cell activation antigen CD26
Type:Enzyme
Mol. Mass.:88235.21
Organism:Sus scrofa (pig)
Description:n/a
Residue:766
Sequence:
MKTPWKVLLGLLGIAALVTVITVPVVLLNKGTDDAAADSRRTYTLTDYLKSTFRVKFYTL
QWISDHEYLYKQENNILLFNAEYGNSSIFLENSTFDELGYSTNDYSVSPDRQFILFEYNY
VKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWITWSPVGHKLAYVWNNDIYVKNEPNL
SSQRITWTGKENVIYNGVTDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSF
YSDESLQYPKTVRIPYPKAGAENPTVKFFVVDTRTLSPNASVTSYQIVPPASVLIGDHYL
CGVTWVTEERISLQWIRRAQNYSIIDICDYDESTGRWISSVARQHIEISTTGWVGRFRPA
EPHFTSDGNSFYKIISNEEGYKHICHFQTDKSNCTFITKGAWEVIGIEALTSDYLYYISN
EHKGMPGGRNLYRIQLNDYTKVTCLSCELNPERCQYYSASFSNKAKYYQLRCFGPGLPLY
TLHSSSSDKELRVLEDNSALDKMLQDVQMPSKKLDVINLHGTKFWYQMILPPHFDKSKKY
PLLIEVYAGPCSQKVDTVFRLSWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT
FEVEDQIEATRQFSKMGFVDDKRIAIWGWSYGGYVTSMVLGAGSGVFKCGIAVAPVSKWE
YYDSVYTERYMGLPTPEDNLDYYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQLS
KALVDAGVDFQTMWYTDEDHGIASNMAHQHIYTHMSHFLKQCFSLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50287059
n/a
NameBDBM50287059
Synonyms:(S)-1-(2-Amino-3-methyl-pentanoyl)-pyrrolidine-2-carbonitrile | CHEMBL1627326 | CHEMBL274249
TypeSmall organic molecule
Emp. Form.C11H19N3O
Mol. Mass.209.2881
SMILESCCC(C)C(N)C(=O)N1CCC[C@H]1C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: