| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50143837 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_80126 (CHEMBL688448) |
|---|
| Ki | 0.18±n/a nM |
|---|
| Citation |  Brynda, J; Rezacova, P; Fabry, M; Horejsi, M; Stouracova, R; Sedlacek, J; Soucek, M; Hradilek, M; Lepsik, M; Konvalinka, J A phenylnorstatine inhibitor binding to HIV-1 protease: geometry, protonation, and subsite-pocket interactions analyzed at atomic resolution. J Med Chem47:2030-6 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50143837 |
|---|
| n/a |
|---|
| Name | BDBM50143837 |
|---|
| Synonyms: | (S)-4-[(S)-2-((2R,3S)-3-Benzyloxycarbonylamino-2-hydroxy-4-phenyl-butyrylamino)-3-phenyl-propionylamino]-4-((S)-1-carbamoyl-3-carboxy-propylcarbamoyl)-butyric acid | CHEMBL264763 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H43N5O11 |
|---|
| Mol. Mass. | 733.7642 |
|---|
| SMILES | NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](O)[C@H](Cc1ccccc1)NC(=O)OCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
