Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 3
LigandBDBM50121900
Substrate/Competitorn/a
Meas. Tech.ChEMBL_106158
EC50 0.098±n/a nM
Citation Wilczynski AWang XSJoseph CGXiang ZBauzo RMScott JWSorensen NBShaw AMMillard WJRichards NGHaskell-Luevano C Identification of putative agouti-related protein(87-132)-melanocortin-4 receptor interactions by homology molecular modeling and validation using chimeric peptide ligands. J Med Chem 47:2194-207 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 3
Name:Melanocortin receptor 3
Synonyms:MC3-R
Type:PROTEIN
Mol. Mass.:35808.24
Organism:Mus musculus
Description:ChEMBL_1498848
Residue:323
Sequence:
MNSSCCLSSVSPMLPNLSEHPAAPPASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVI
LAVVRNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIAVINSDSLTLEDQFIQHMDNIF
DSMICISLVASICNLLAIAIDRYVTIFYALRYHSIMTVRKALTLIGVIWVCCGICGVMFI
IYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAVLPPAGVVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFKEILCGCNSMNLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121900
n/a
NameBDBM50121900
Synonyms:Ac-Ser-Try-Ser-Nle-Glu-His-DPhe-Arg-Trp-Gly-Lys-Pro-Val-NH2 | CHEMBL439490
TypeSmall organic molecule
Emp. Form.C78H111N21O19
Mol. Mass.1646.8452
SMILESCCCC[C@H](NC(=O)C(CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(C)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@@H]1C(=O)N[C@H](C(C)C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: