Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterstitial collagenase
LigandBDBM50082556
Substrate/Competitorn/a
Meas. Tech.ChEMBL_106147
Ki 8.20±n/a nM
Citation Källblad PTodorov NPWillems HMAlberts IL Receptor flexibility in the in silico screening of reagents in the S1' pocket of human collagenase. J Med Chem 47:2761-7 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interstitial collagenase
Name:Interstitial collagenase
Synonyms:Fibroblast collagenase | MMP1 | Matrix metalloproteinase-1 | Matrix metalloproteinase-1 (MMP-1)
Type:Enzyme
Mol. Mass.:54010.26
Organism:Homo sapiens (Human)
Description:
Residue:469
Sequence:
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50082556
n/a
NameBDBM50082556
Synonyms:(S)-2,2-Dimethyl-4-[4-(pyridin-4-yloxy)-benzenesulfonyl]-thiomorpholine-3-carboxylic acid hydroxyamide | (S)-N-hydroxy-2,2-dimethyl-4-(4-(pyridin-4-yloxy)phenylsulfonyl)thiomorpholine-3-carboxamide | 2,2-Dimethyl-4-[4-(pyridin-4-yloxy)-benzenesulfonyl]-thiomorpholine-3-carboxylic acid hydroxyamide | 2,2-Dimethyl-4-[4-(pyridin-4-yloxy)-benzenesulfonyl]-thiomorpholine-3-carboxylic acid hydroxyamide(AG 3340) | 2,2-Dimethyl-4-[4-(pyridin-4-yloxy)-benzenesulfonyl]-thiomorpholine-3-carboxylic acid hydroxyamide(prinomastat) | AG-3340 | CHEMBL75094 | Prinomastat
TypeSmall organic molecule
Emp. Form.C18H21N3O5S2
Mol. Mass.423.506
SMILESCC1(C)SCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(Oc2ccncc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: