Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin F2-alpha receptor
LigandBDBM50150892
Substrate/Competitorn/a
Meas. Tech.ChEMBL_310565
EC50 67±n/a nM
Citation Selliah RDHellberg MRSharif NAMcLaughlin MAWilliams GWScott DAEarnest DHaggard KSDean WDDelgado PGaines MSConrow REKlimko PG AL-12182, a novel 11-oxa prostaglandin analog with topical ocular hypotensive activity in the monkey. Bioorg Med Chem Lett 14:4525-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin F2-alpha receptor
Name:Prostaglandin F2-alpha receptor
Synonyms:PGF receptor | PGF2 alpha receptor | PGF2-alpha receptor | PTGFR | Prostaglandin F | Prostanoid FP receptor
Type:Enzyme
Mol. Mass.:40072.29
Organism:Homo sapiens (Human)
Description:P43088
Residue:359
Sequence:
MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQ
KSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGL
CPLLLGSVMAIERCIGVTKPIFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQ
ASRTWCFYNTEDIKDWEDRFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQG
RSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSLETCETTLFALRMATWNQILD
PWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50150892
n/a
NameBDBM50150892
Synonyms:(Z)-8-{(2R,3S,4R)-4-Hydroxy-2-[(E)-(R)-3-hydroxy-4-(3-trifluoromethyl-phenoxy)-but-1-enyl]-tetrahydro-furan-3-yl}-oct-4-enoic acid | CHEMBL185559
TypeSmall organic molecule
Emp. Form.C23H29F3O6
Mol. Mass.458.468
SMILESO[C@@H](COc1cccc(c1)C(F)(F)F)\C=C\[C@H]1OC[C@H](O)[C@@H]1CCC\C=C/CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: