Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid EP1 Receptor
LigandBDBM17638
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302495
Ki>10000±n/a nM
Citation Torisu KKobayashi KIwahashi MEgashira HNakai YOkada YNanbu FOhuchida SNakai HToda M Discovery of new chemical leads for prostaglandin D2 receptor antagonists. Bioorg Med Chem Lett 14:4557-62 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid EP1 Receptor
Name:Prostanoid EP1 receptor
Synonyms:PGE receptor, EP1 subtype | Prostaglandin E1 | Prostaglandin E2 receptor EP1 subtype
Type:G-protein coupled receptor
Mol. Mass.:43000.62
Organism:Mus musculus (Mouse)
Description:n/a
Residue:405
Sequence:
MSPCGLNLSLADEAATCATPRLPNTSVVLPTGDNGTSPALPIFSMTLGAVSNVLALALLA
QVAGRMRRRRSAATFLLFVASLLAIDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMV
FFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALAVLAAMALAVALLPLVHVGR
YELQYPGTWCFISLGPRGGWRQALLAGLFAGLGLAALLAALVCNTLSGLALLRARWRRRR
SRRFRKTAGPDDRRRWGSRGPRLASASSASSITSATATLRSSRGGGSARRVHAHDVEMVG
QLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAVRLASWNQILDPWVYILLRQA
MLRQLLRLLPLRVSAKGGPTELGLTKSAWEASSLRSSRHSGFSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17638
n/a
NameBDBM17638
Synonyms:2-{1-[(4-chlorophenyl)carbonyl]-5-methoxy-2-methyl-1H-indol-3-yl}acetic acid | CHEMBL6 | Indocin | Indomethacin | US9271961, Indomethacin | indometacin
TypeSmall organic molecule
Emp. Form.C19H16ClNO4
Mol. Mass.357.788
SMILESCOc1ccc2n(C(=O)c3ccc(Cl)cc3)c(C)c(CC(O)=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: