Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 1
LigandBDBM50152329
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306053
IC50 0.33±n/a nM
Citation Yan LHale JJLynch CLBudhu RGentry AMills SGHajdu RKeohane CARosenbach MJMilligan JAShei GJChrebet GBergstrom JCard DRosen HMandala SM Design and synthesis of conformationally constrained 3-(N-alkylamino)propylphosphonic acids as potent agonists of sphingosine-1-phosphate (S1P) receptors. Bioorg Med Chem Lett 14:4861-6 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 1
Name:Sphingosine 1-phosphate receptor
Synonyms:CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1
Type:Enzyme
Mol. Mass.:42836.02
Organism:Homo sapiens (Human)
Description:P21453
Residue:382
Sequence:
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50152329
n/a
NameBDBM50152329
Synonyms:1-(4-nonylbenzyl)pyrrolidin-3-ylphosphonic acid | CHEMBL184349 | [1-(4-Nonyl-benzyl)-pyrrolidin-3-yl]-phosphonic acid
TypeSmall organic molecule
Emp. Form.C20H34NO3P
Mol. Mass.367.4626
SMILESCCCCCCCCCc1ccc(CN2CCC(C2)P(O)(O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: