Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 5
LigandBDBM50152322
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306057
IC50 0.73±n/a nM
Citation Yan LHale JJLynch CLBudhu RGentry AMills SGHajdu RKeohane CARosenbach MJMilligan JAShei GJChrebet GBergstrom JCard DRosen HMandala SM Design and synthesis of conformationally constrained 3-(N-alkylamino)propylphosphonic acids as potent agonists of sphingosine-1-phosphate (S1P) receptors. Bioorg Med Chem Lett 14:4861-6 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 5
Name:Sphingosine 1-phosphate receptor 5
Synonyms:Endothelial differentiation sphingolipid G-protein-coupled receptor 8 | S1P5 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-8
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41796.42
Organism:Homo sapiens (Human)
Description:n/a
Residue:398
Sequence:
MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50152322
n/a
NameBDBM50152322
Synonyms:CHEMBL184879 | {2-[5-(4-Nonyl-phenyl)-pyrrolidin-2-yl]-ethyl}-phosphonic acid
TypeSmall organic molecule
Emp. Form.C21H36NO3P
Mol. Mass.381.4892
SMILESCCCCCCCCCc1ccc(cc1)C1CCC(CCP(O)(O)=O)N1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: