Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM50166739
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303757
Ki 24±n/a nM
Citation Press NJTaylor RJFullerton JDTranter PMcCarthy CKeller THBrown LCheung RChristie JHaberthuer SHatto JDKeenan MMercer MKPress NESahri HTuffnell ARTweed MFozard JR A new orally bioavailable dual adenosine A2B/A3 receptor antagonist with therapeutic potential. Bioorg Med Chem Lett 15:3081-5 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50166739
n/a
NameBDBM50166739
Synonyms:3-[2-(Pyridin-2-ylamino)-5-[1,2,4]triazol-1-yl-thiazol-4-yl]-benzonitrile | CHEMBL195140
TypeSmall organic molecule
Emp. Form.C17H11N7S
Mol. Mass.345.381
SMILESN#Cc1cccc(c1)-c1nc(Nc2ccccn2)sc1-n1cncn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: