Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2b
LigandBDBM50166735
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303806
Ki 10±n/a nM
Citation Press NJTaylor RJFullerton JDTranter PMcCarthy CKeller THBrown LCheung RChristie JHaberthuer SHatto JDKeenan MMercer MKPress NESahri HTuffnell ARTweed MFozard JR A new orally bioavailable dual adenosine A2B/A3 receptor antagonist with therapeutic potential. Bioorg Med Chem Lett 15:3081-5 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2b
Name:Adenosine receptor
Synonyms:ADENOSINE A2B | ADORA2B | Adenosine receptor A2B (A2B)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36341.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:332
Sequence:
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50166735
n/a
NameBDBM50166735
Synonyms:3-[5-(2-Methyl-imidazol-1-yl)-2-(pyrazin-2-ylamino)-thiazol-4-yl]-benzonitrile | CHEMBL197103
TypeSmall organic molecule
Emp. Form.C20H16N6S
Mol. Mass.372.446
SMILESCc1nccn1-c1sc(Nc2cccc(C)n2)nc1-c1cccc(c1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: