| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP3 subtype |
|---|
| Ligand | BDBM50167887 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_303235 (CHEMBL827200) |
|---|
| Ki | 8200±n/a nM |
|---|
| Citation |  Hattori, K; Tanaka, A; Okitsu, O; Tabuchi, S; Taniguchi, K; Nishio, M; Koyama, S; Higaki, M; Seki, J; Sakane, K Discovery of diphenylcarbamate derivatives as highly potent and selective IP receptor agonists: orally active prostacyclin mimetics. Part 3. Bioorg Med Chem Lett15:3091-5 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP3 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP3 subtype |
|---|
| Synonyms: | PE2R3_HUMAN | PGE receptor, EP3 subtype | PGE2-R | PTGER3 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43335.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43115 |
|---|
| Residue: | 390 |
|---|
| Sequence: | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
|
|
|
|---|
| BDBM50167887 |
|---|
| n/a |
|---|
| Name | BDBM50167887 |
|---|
| Synonyms: | (R)-2-(6-((diphenylcarbamoyloxy)methyl)-6-hydroxy-5,6,7,8-tetrahydronaphthalen-1-yloxy)acetic acid | CHEMBL196779 | {(R)-6-[(Diphenylcarbamoyloxy)-methyl]-6-hydroxy-5,6,7,8-tetrahydro-naphthalen-1-yloxy}-acetic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H25NO6 |
|---|
| Mol. Mass. | 447.4798 |
|---|
| SMILES | OC(=O)COc1cccc2C[C@@](O)(COC(=O)N(c3ccccc3)c3ccccc3)CCc12 |
|---|
| Structure | 
|
|---|
Search and Browse
