Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGRM8
LigandBDBM17657
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306301
IC50 5.7±n/a nM
Citation Wheeler WJClodfelter DKCollado IKulanthaivel PPedregal CStoddard EAWright RASchoepp DD (2S,1'S,2'R,3'R)-2(2'-Carboxy-3'-hydroxymethylcyclopropyl)glycine-[3H], a potent and selective radioligand for labeling group 2 and 3 metabotropic glutamate receptors. Bioorg Med Chem Lett 15:349-51 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GRM8
Name:Metabotropic glutamate receptor 8
Synonyms:Metabotropic glutamate receptor 8 | mGluR8 | metabotropic glutamate 8
Type:Enzyme Catalytic Domain
Mol. Mass.:101759.58
Organism:Homo sapiens (Human)
Description:metabotropic glutamate 8 GRM8 HUMAN::O00222
Residue:908
Sequence:
MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER
GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITN
KSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
IIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17657
n/a
NameBDBM17657
Synonyms:(2S)-2-aminopentanedioic acid | (S)-Glu | D-Glutamate | Glutamate | L-Glu | L-Glutamate | L-Glutamic acid | L-[14C(U)]glutamate | L-gluatmate
TypeAmino Acid
Emp. Form.C5H9NO4
Mol. Mass.147.1293
SMILESN[C@@H](CCC(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: