Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP2 subtype |
---|
Ligand | BDBM50370461 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_302795 (CHEMBL839479) |
---|
Ki | 630±n/a nM |
---|
Citation | Belley, M; Gallant, M; Roy, B; Houde, K; Lachance, N; Labelle, M; Trimble, LA; Chauret, N; Li, C; Sawyer, N; Tremblay, N; Lamontagne, S; Carrière, MC; Denis, D; Greig, GM; Slipetz, D; Metters, KM; Gordon, R; Chan, CC; Zamboni, RJ Structure-activity relationship studies on ortho-substituted cinnamic acids, a new class of selective EP(3) antagonists. Bioorg Med Chem Lett15:527-30 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP2 subtype |
---|
Name: | Prostaglandin E2 receptor EP2 subtype |
Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
Type: | Enzyme |
Mol. Mass.: | 39775.71 |
Organism: | Homo sapiens (Human) |
Description: | P43116 |
Residue: | 358 |
Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
BDBM50370461 |
---|
n/a |
---|
Name | BDBM50370461 |
Synonyms: | CHEMBL1237299 |
Type | Small organic molecule |
Emp. Form. | C26H24O3 |
Mol. Mass. | 384.467 |
SMILES | Cc1cccc(C\C=C\c2cccc(\C=C\C(O)=O)c2)c1OCc1ccccc1 |
Structure |
|