Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor
LigandBDBM50370462
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302796
Ki 60±n/a nM
Citation Belley MGallant MRoy BHoude KLachance NLabelle MTrimble LAChauret NLi CSawyer NTremblay NLamontagne SCarrière MCDenis DGreig GMSlipetz DMetters KMGordon RChan CCZamboni RJ Structure-activity relationship studies on ortho-substituted cinnamic acids, a new class of selective EP(3) antagonists. Bioorg Med Chem Lett 15:527-30 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor, EP3 subtype | PGE2-R | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor
Type:Enzyme
Mol. Mass.:43335.03
Organism:Homo sapiens (Human)
Description:P43115
Residue:390
Sequence:
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50370462
n/a
NameBDBM50370462
Synonyms:CHEMBL1237304
TypeSmall organic molecule
Emp. Form.C24H20O3
Mol. Mass.356.4138
SMILESOC(=O)\C=C\c1ccccc1C\C=C/c1ccccc1Oc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: