| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP3 subtype |
|---|
| Ligand | BDBM50159765 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_302796 (CHEMBL839480) |
|---|
| Ki | 19±n/a nM |
|---|
| Citation |  Belley, M; Gallant, M; Roy, B; Houde, K; Lachance, N; Labelle, M; Trimble, LA; Chauret, N; Li, C; Sawyer, N; Tremblay, N; Lamontagne, S; Carrière, MC; Denis, D; Greig, GM; Slipetz, D; Metters, KM; Gordon, R; Chan, CC; Zamboni, RJ Structure-activity relationship studies on ortho-substituted cinnamic acids, a new class of selective EP(3) antagonists. Bioorg Med Chem Lett15:527-30 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP3 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP3 subtype |
|---|
| Synonyms: | PE2R3_HUMAN | PGE receptor, EP3 subtype | PGE2-R | PTGER3 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43335.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43115 |
|---|
| Residue: | 390 |
|---|
| Sequence: | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
|
|
|
|---|
| BDBM50159765 |
|---|
| n/a |
|---|
| Name | BDBM50159765 |
|---|
| Synonyms: | (E)-3-{2-[3-(2-Benzyloxy-3-methoxy-phenyl)-propyl]-phenyl}-acrylic acid | CHEMBL181691 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H26O4 |
|---|
| Mol. Mass. | 402.4822 |
|---|
| SMILES | COc1cccc(CCCc2ccccc2\C=C\C(O)=O)c1OCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
