Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase VII
LigandBDBM10880
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302420
Ki 16±n/a nM
Citation Vullo DVoipio JInnocenti ARivera CRanki HScozzafava AKaila KSupuran CT Carbonic anhydrase inhibitors. Inhibition of the human cytosolic isozyme VII with aromatic and heterocyclic sulfonamides. Bioorg Med Chem Lett 15:971-6 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase VII
Name:Carbonic anhydrase VII
Synonyms:CA-VII | Carbonate dehydratase VII | Carbonic anhydrase 7
Type:PROTEIN
Mol. Mass.:29917.41
Organism:Mus musculus
Description:ChEMBL_302420
Residue:264
Sequence:
MTGHHCWGYGQDDGPSNWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELFYEACMSLS
ITNNGHSVQVDFNDSDDRTVVSGGPLEGPYRLKQLHFHWGKKRDMGSEHTVDGKSFPSEL
HLVHWNAKKYSTFGEAAAAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKDTKAQFSC
FNPKCLLPTSRHYWTYPGSLTTPPLSESVTWIVLREPIRISERQMEKFRSLLFTSEDDER
IHMVDNFRPPQPLKGRVVKASFQA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10880
n/a
NameBDBM10880
Synonyms:AZA | AZA2 | AZM acetazolamide | Acerazolamide, AAZ | Acetazolamide | Acetazolamide (AAZ) | Acetazolamide (AZA) | Acetazolamide (AZM) | Acetazolamide, 5 | Acetazolamide, AAZ | Acetazolamide, AZA | Acetazolamide, AZM | CHEMBL20 | N-(5-sulfamoyl-1,3,4-thiadiazol-2-yl)acetamide | Sulfonamide, 1 | US10172837, Acetazolamide | sulfonamide 1
TypeSmall organic molecule
Emp. Form.C4H6N4O3S2
Mol. Mass.222.245
SMILESCC(=O)Nc1nnc(s1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: