| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 4 |
|---|
| Ligand | BDBM50150700 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_305061 (CHEMBL832693) |
|---|
| IC50 | 3300±n/a nM |
|---|
| Citation |  Engler, TA; Henry, JR; Malhotra, S; Cunningham, B; Furness, K; Brozinick, J; Burkholder, TP; Clay, MP; Clayton, J; Diefenbacher, C; Hawkins, E; Iversen, PW; Li, Y; Lindstrom, TD; Marquart, AL; McLean, J; Mendel, D; Misener, E; Briere, D; O'Toole, JC; Porter, WJ; Queener, S; Reel, JK; Owens, RA; Brier, RA; Eessalu, TE; Wagner, JR; Campbell, RM; Vaughn, R Substituted 3-imidazo[1,2-a]pyridin-3-yl- 4-(1,2,3,4-tetrahydro-[1,4]diazepino-[6,7,1-hi]indol-7-yl)pyrrole-2,5-diones as highly selective and potent inhibitors of glycogen synthase kinase-3. J Med Chem47:3934-7 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 4 |
|---|
| Name: | Cyclin-dependent kinase 4 |
|---|
| Synonyms: | CDK4 | CDK4_HUMAN | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3 |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 33731.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11802 |
|---|
| Residue: | 303 |
|---|
| Sequence: | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
|
|
|
|---|
| BDBM50150700 |
|---|
| n/a |
|---|
| Name | BDBM50150700 |
|---|
| Synonyms: | 7-(4-Imidazo[1,2-a]pyridin-3-yl-2,5-dioxo-2,5-dihydro-1H-pyrrol-3-yl)-3,4-dihydro-1H-[1,4]diazepino[6,7,1-hi]indole-2-carboxylic acid isopropyl ester | CHEMBL363058 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H23N5O4 |
|---|
| Mol. Mass. | 469.4919 |
|---|
| SMILES | CC(C)OC(=O)N1CCn2cc(C3=C(C(=O)NC3=O)c3cnc4ccccn34)c3cccc(C1)c23 |t:12| |
|---|
| Structure | 
|
|---|
Search and Browse
