| Reaction Details |
|---|
 | Report a problem with these data |
| Target | MO15-related protein kinase Pfmrk |
|---|
| Ligand | BDBM5718 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_306159 (CHEMBL832347) |
|---|
| IC50 | 1100000±n/a nM |
|---|
| Citation |  Bhattacharjee, AK; Geyer, JA; Woodard, CL; Kathcart, AK; Nichols, DA; Prigge, ST; Li, Z; Mott, BT; Waters, NC A three-dimensional in silico pharmacophore model for inhibition of Plasmodium falciparum cyclin-dependent kinases and discovery of different classes of novel Pfmrk specific inhibitors. J Med Chem47:5418-26 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| MO15-related protein kinase Pfmrk |
|---|
| Name: | MO15-related protein kinase Pfmrk |
|---|
| Synonyms: | Protein kinase Pfmrk |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 37992.30 |
|---|
| Organism: | Plasmodium falciparum |
|---|
| Description: | ChEMBL_640752 |
|---|
| Residue: | 324 |
|---|
| Sequence: | MENNSTERYIFKPNFLGEGSYGKVYKAYDTILKKEVAIKKMKLNEISNYIDDCGINFVLL
REIKIMKEIKHKNIMSALDLYCEKDYINLVMEIMDYDLSKIINRKIFLTDSQKKCILLQI
LNGLNVLHKYYFMHRDLSPANIFINKKGEVKLADFGLCTKYGYDMYSDKLFRDKYKKNLN
LTSKVVTLWYRAPELLLGSNKYNSSIDMWSFGCIFAELLLQKALFPGENEIDQLGKIFFL
LGTPNENNWPEALCLPLYTEFTKATKKDFKTYFKIDDDDCIDLLTSFLKLNAHERISAED
AMKHRYFFNDPLPCDISQLPFNDL
|
|
|
|---|
| BDBM5718 |
|---|
| n/a |
|---|
| Name | BDBM5718 |
|---|
| Synonyms: | 2,6,9-Trisubstituted purine deriv. 26 | 2-{[6-(benzylamino)-9-methyl-9H-purin-2-yl]amino}ethan-1-ol | 2-{[6-(benzylamino)-9-methyl-9H-purin-2-yl]amino}ethanol | 6-(benzylamino)-2-[(2-hydroxyethyl)amino]-9-methylpurine | CHEMBL280074 | Olomoucine | purine deriv. 5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H18N6O |
|---|
| Mol. Mass. | 298.343 |
|---|
| SMILES | Cn1cnc2c(NCc3ccccc3)nc(NCCO)nc12 |
|---|
| Structure | 
|
|---|
Search and Browse
