Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50156140
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302776
Ki 0.09±n/a nM
Citation Shuman CFVrang LDanielson UH Improved structure-activity relationship analysis of HIV-1 protease inhibitors using interaction kinetic data. J Med Chem 47:5953-61 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156140
n/a
NameBDBM50156140
Synonyms:1,6-Bis-(2,3-dimethyl-butyrylamino)-3,4-dihydroxy-5-[4-(2-methoxycarbonyl-vinyl)-phenoxy]-1,6-dioxo-hexan-2-ol anion
TypeSmall organic molecule
Emp. Form.C28H39N2O10
Mol. Mass.563.6172
SMILESCOC(=O)\C=C\c1ccc(O[C@H]([C@H](O)[C@@H](O)[C@@H]([O-])C(=O)NC(=O)[C@@H](C)C(C)C)C(=O)NC(=O)[C@@H](C)C(C)C)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: