| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Human immunodeficiency virus type 1 protease |
|---|
| Ligand | BDBM517 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_302776 |
|---|
| Ki | 0.31±n/a nM |
|---|
| Citation |  Shuman CF; Vrang L; Danielson UH Improved structure-activity relationship analysis of HIV-1 protease inhibitors using interaction kinetic data. J Med Chem 47:5953-61 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Human immunodeficiency virus type 1 protease |
|---|
| Name: | Human immunodeficiency virus type 1 protease |
|---|
| Synonyms: | Pol polyprotein |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | n/a |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM517 |
|---|
| n/a |
|---|
| Name | BDBM517 |
|---|
| Synonyms: | (2S)-1-[(2S,4R)-4-benzyl-2-hydroxy-4-{[(1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-yl]carbamoyl}butyl]-N-tert-butyl-4-(pyridin-3-ylmethyl)piperazine-2-carboxamide | CHEMBL115 | Crixivan | INDINAVIR SULFATE | Indinavir | Indinavir, 19 | L-735, 524 | MK639 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | n/a |
|---|
| Mol. Mass. | n/a |
|---|
| SMILES | n/a |
|---|
| Structure | 
|
|---|
Search and Browse
