Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50159033
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303199
Ki 1.4±n/a nM
Citation Costantino LGandolfi FSorbi CFranchini SPrezzavento OVittorio FRonsisvalle GLeonardi APoggesi EBrasili L Synthesis and structure-activity relationships of 1-aralkyl-4-benzylpiperidine and 1-aralkyl-4-benzylpiperazine derivatives as potent sigma ligands. J Med Chem 48:266-73 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50159033
n/a
NameBDBM50159033
Synonyms:2-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one | CHEMBL179397
TypeSmall organic molecule
Emp. Form.C22H25NO2
Mol. Mass.335.4394
SMILESO=C1CC(CN2CCC(Cc3ccccc3)CC2)Oc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: