Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 9A
LigandBDBM14363
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302484
Ki 35000±n/a nM
Citation Manallack DTHughes RAThompson PE The next generation of phosphodiesterase inhibitors: structural clues to ligand and substrate selectivity of phosphodiesterases. J Med Chem 48:3449-62 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 9A
Name:3',5'-cyclic phosphodiesterase
Synonyms:High affinity cGMP-specific 3'',5''-cyclic phosphodiesterase 9A | Phosphodiesterase 9A (PDE9) | Phosphodiesterase 9A (PDE9A)
Type:Protein
Mol. Mass.:68488.40
Organism:Homo sapiens (Human)
Description:O76083
Residue:593
Sequence:
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRRE
GAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV
PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLF
CVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN
NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIML
QPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14363
n/a
NameBDBM14363
Synonyms:3-(2-propoxyphenyl)-2,4,7,8,9-pentazabicyclo[4.3.0]nona-1,3,6-trien-5-one | 5-(2-propoxyphenyl)-2H,3H,7H-[1,2,3]triazolo[4,5-d]pyrimidin-7-one | Tocris-0947 | ZAPRINAST | Zaprinast
TypeSmall organic molecule
Emp. Form.C13H13N5O2
Mol. Mass.271.2746
SMILESCCCOc1ccccc1-c1nc2nn[nH]c2c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: