| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Endolysin [L99A] |
|---|
| Ligand | BDBM50008556 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_302213 (CHEMBL826986) |
|---|
| Kd | 364000±n/a nM |
|---|
| Citation |  Graves, AP; Brenk, R; Shoichet, BK Decoys for docking. J Med Chem48:3714-28 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Endolysin [L99A] |
|---|
| Name: | Endolysin [L99A] |
|---|
| Synonyms: | E | ENLYS_BPT4 | Lysozyme(L99A) |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 18657.83 |
|---|
| Organism: | Enterobacteria phage T4 |
|---|
| Description: | P00720(L99A) |
|---|
| Residue: | 164 |
|---|
| Sequence: | MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITK
DEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCAAINMVFQMGETGVAGFTNSLRM
LQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL
|
|
|
|---|
| BDBM50008556 |
|---|
| n/a |
|---|
| Name | BDBM50008556 |
|---|
| Synonyms: | 1,3-Dimethylbenzol | 1,3-xylene | 3-xylene | CHEMBL286727 | m-Xylol | m-dimethylbenzene | m-methyltoluene | m-xylene | meta-xylene |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H10 |
|---|
| Mol. Mass. | 106.165 |
|---|
| SMILES | Cc1cccc(C)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
