Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 reverse transcriptase
LigandBDBM1866
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305759
IC50>20000±n/a nM
Citation Ranise ASpallarossa ACesarini SBondavalli FSchenone SBruno OMenozzi GFossa PMosti LLa Colla MSanna GMurreddu MCollu GBusonera BMarongiu MEPani ALa Colla PLoddo R Structure-based design, parallel synthesis, structure-activity relationship, and molecular modeling studies of thiocarbamates, new potent non-nucleoside HIV-1 reverse transcriptase inhibitor isosteres of phenethylthiazolylthiourea derivatives. J Med Chem 48:3858-73 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 reverse transcriptase
Name:Human immunodeficiency virus type 1 reverse transcriptase
Synonyms:Reverse transcriptase/RNaseH
Type:PROTEIN
Mol. Mass.:65229.15
Organism:Human immunodeficiency virus 1
Description:ChEMBL_1473730
Residue:566
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLRTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVLFLDGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM1866
n/a
NameBDBM1866
Synonyms:3-(5-bromopyridin-2-yl)-1-[2-(pyridin-2-yl)ethyl]thiourea hydrochloride | LY-300046 HCl | LY300046HCl | N-(2-(2-Pyridylethyl))-N -(2-(5-bromopyridyl))thiourea | PETT deriv. | Trovirdine
TypeSmall organic molecule
Emp. Form.C13H13BrN4S
Mol. Mass.337.238
SMILESBrc1ccc(NC(=S)NCCc2ccccn2)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: