Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetc-Jun N-terminal kinase 3
LigandBDBM50169985
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304976
IC50 41±n/a nM
Citation Gaillard PJeanclaude-Etter IArdissone VArkinstall SCambet YCamps MChabert CChurch DCirillo RGretener DHalazy SNichols ASzyndralewiez CVitte PAGotteland JP Design and synthesis of the first generation of novel potent, selective, and in vivo active (benzothiazol-2-yl)acetonitrile inhibitors of the c-Jun N-terminal kinase. J Med Chem 48:4596-607 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
c-Jun N-terminal kinase 3
Name:c-Jun N-terminal kinase 3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:52532.30
Organism:Rattus norvegicus
Description:ChEMBL_1460661
Residue:464
Sequence:
MSLHFLYYCSEPTLDVKIAFCQGFDKHVDVSSVVKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLSAIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50169985
n/a
NameBDBM50169985
Synonyms:4-(2-(4-(benzo[d]thiazol-2(3H)-ylidene(cyano)methyl)pyrimidin-2-ylamino)ethyl)benzenesulfonamide | 4-[2-(4-{[3H-Benzothiazol-(2Z)-ylidene]-cyano-methyl}-pyrimidin-2-ylamino)-ethyl]-benzenesulfonamide | CHEMBL363355
TypeSmall organic molecule
Emp. Form.C21H18N6O2S2
Mol. Mass.450.537
SMILESNS(=O)(=O)c1ccc(CCNc2nccc(n2)C(C#N)c2nc3ccccc3s2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: