Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-Hydroxytryptamine receptor 6 (5-HT6)
LigandBDBM50159209
Substrate/Competitorn/a
Meas. Tech.ChEMBL_310551
EC50 0.8±n/a nM
Citation Cole DCLennox WJLombardi SEllingboe JWBernotas RCTawa GJMazandarani HSmith DLZhang GCoupet JSchechter LE Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. J Med Chem 48:353-6 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-Hydroxytryptamine receptor 6 (5-HT6)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-6 | 5-HT6 | 5-hydroxytryptamine receptor 6 | 5-hydroxytryptamine receptor 6 (5-HT-6) | 5-hydroxytryptamine receptor 6 (5-HT6R) | 5-hydroxytryptamine receptor 6 (5HT6) | Serotonin (5-HT3) receptor | Serotonin 6 (5-HT6) receptor | Serotonin Receptor 6
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46968.43
Organism:Homo sapiens (Human)
Description:Cultured Hela cells expressing h5-HT6 receptors.
Residue:440
Sequence:
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50159209
n/a
NameBDBM50159209
Synonyms:3,5-Dimethyl-isoxazole-4-sulfonic acid [3-((R)-1-methyl-pyrrolidin-2-ylmethyl)-1H-indol-5-yl]-amide
TypeSmall organic molecule
Emp. Form.C19H24N4O3S
Mol. Mass.388.484
SMILESCN1CCCC1Cc1c[nH]c2ccc(NS(=O)(=O)c3c(C)noc3C)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: