Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin-converting enzyme 1 (ECE1)
LigandBDBM50159365
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305832
IC50 72.9±n/a nM
Citation Berger YDehmlow HBlum-Kaelin DKitas EALöffler BMAebi JDJuillerat-Jeanneret L Endothelin-converting enzyme-1 inhibition and growth of human glioblastoma cells. J Med Chem 48:483-98 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Endothelin-converting enzyme 1 (ECE1)
Name:Endothelin-converting enzyme 1
Synonyms:ECE-1 | Endothelin-Converting Enzyme 1
Type:Enzyme
Mol. Mass.:87155.11
Organism:Homo sapiens (Human)
Description:P42892
Residue:770
Sequence:
MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWA
ARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVD
PCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQV
YYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQDTLQVVTAHYRTSPFFSVY
VSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNYMVQLGKLLGGGDEEAI
RPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLPFLNTIFYPVE
INESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEV
MYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLS
TLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNF
SWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGG
IGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKRQTECMVEQYSNYSVNGEPVN
GRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTP
ESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50159365
n/a
NameBDBM50159365
Synonyms:(3R,5S)-5-{[(2,5-difluorobenzyl)amino]methyl}-1-(5-propylpyrimidin-2-yl)pyrrolidine-3-thiol | CHEMBL194651
TypeSmall organic molecule
Emp. Form.C19H24F2N4S
Mol. Mass.378.482
SMILESCCCc1cnc(nc1)N1C[C@H](S)CC1CNCc1cc(F)ccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: