Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOligopeptide transporter small intestine isoform
LigandBDBM50370611
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306462
IC50 260000±n/a nM
Citation Song XVig BSLorenzi PLDrach JCTownsend LBAmidon GL Amino acid ester prodrugs of the antiviral agent 2-bromo-5,6-dichloro-1-(beta-D-ribofuranosyl)benzimidazole as potential substrates of hPEPT1 transporter. J Med Chem 48:1274-7 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oligopeptide transporter small intestine isoform
Name:Oligopeptide transporter small intestine isoform
Synonyms:Intestinal H(+)/peptide cotransporter | Oligopeptide transporter, small intestine isoform | Peptide transporter 1
Type:PROTEIN
Mol. Mass.:78818.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1488839
Residue:708
Sequence:
MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPV
HVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCI
GFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQ
GSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKK
MAVGMVLASMAFVVAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGP
MSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQK
PEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQ
PNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSV
TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVC
VIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMSGANSQKQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50370611
n/a
NameBDBM50370611
Synonyms:CHEMBL610518
TypeSmall organic molecule
Emp. Form.C16H16BrCl2N3O7
Mol. Mass.513.124
SMILESN[C@@H](CC(O)=O)C(=O)OC[C@H]1OC([C@H](O)[C@@H]1O)n1c(Br)nc2cc(Cl)c(Cl)cc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: