Reaction Details |
| Report a problem with these data |
Target | Protein-S-isoprenylcysteine O-methyltransferase |
---|
Ligand | BDBM50174226 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_320848 (CHEMBL884633) |
---|
Ki | 13200±n/a nM |
---|
Citation | Henriksen, BS; Anderson, JL; Hrycyna, CA; Gibbs, RA Synthesis of desthio prenylcysteine analogs: sulfur is important for biological activity. Bioorg Med Chem Lett15:5080-3 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protein-S-isoprenylcysteine O-methyltransferase |
---|
Name: | Protein-S-isoprenylcysteine O-methyltransferase |
Synonyms: | Isoprenylcysteine carboxyl methyltransferase | STE14 | STE14_YEAST |
Type: | PROTEIN |
Mol. Mass.: | 27893.87 |
Organism: | Saccharomyces cerevisiae |
Description: | ChEMBL_321482 |
Residue: | 239 |
Sequence: | MHQDFQEDEHEYPDIRRNPLHEVTMTSYILGILLGIFVGLFPQIRFKNFNLFIIALSLFH
FLEYYITAKYNPLKVHSESFLLNNGKSYMAAHSFAILECLVESFLFPDLKIFSYSLATKL
CTVLGCLLVILGQYTRTIAMHTAGHSFSHIVKTKKESDHVLVKTGVYSWSRHPSYLGFFW
WAIGTQLLLLNPLSLVIFIFVLWKFFSDRIRVEEKYLIEFFSAEYIEYKNKVGVGIPFI
|
|
|
BDBM50174226 |
---|
n/a |
---|
Name | BDBM50174226 |
Synonyms: | 2-acetamido-3-[(2E,6E,10E)-3,7,11,15-tetramethylhexadeca-2,6,10,14-tetraene-1-sulfinyl]propanoate | Prenylcysteine derivative |
Type | Small organic molecule |
Emp. Form. | C25H40NO4S |
Mol. Mass. | 450.655 |
SMILES | [#6]\[#6](-[#6])=[#6]/[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]S(=O)[#6]-[#6](-[#7]-[#6](-[#6])=O)-[#6](-[#8-])=O |
Structure |
|